PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00034.1.g01400.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 331aa    MW: 36598.8 Da    PI: 6.5175
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00034.1.g01400.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS334.81.5e-102932673374
                          GRAS  73 nsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg 153
                                   + +e++aa++  ++++P+l+++  +aNq +le +e e+ vH++D++    +QW+ Ll+ +a+Rpegpp+lR+Tgv++    
  Zjn_sc00034.1.g01400.1.am.mk   9 TAAEVAAARRHIVDLCPFLRLAGAAANQSVLEVMEAEKVVHVVDLGGADATQWLELLHLFAARPEGPPHLRLTGVSE---- 85 
                                   46788999999******************************************************************.... PP

                          GRAS 154 skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll.................... 214
                                   ++e l +t+  L+k Ae+l+vpf+fn+ v++rl++l++e+Lrvk+gEala+ ++lqlh ll                    
  Zjn_sc00034.1.g01400.1.am.mk  86 HREILTQTAMVLSKEAERLDVPFQFNP-VVTRLDTLDVESLRVKTGEALAITSSLQLHCLLasdddsaavvgkdkdsrrsp 165
                                   9**************************.79***********************************************9997 PP

                          GRAS 215 .desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                                    +   +++s+ d++L ++++lsPk+vvv+eqea+hn++ + erf+eal+yy+alfd+le+ ++r s er+ vEr +lg+ei
  Zjn_sc00034.1.g01400.1.am.mk 166 eSGLSPSTSRVDAFLGALWGLSPKIVVVTEQEASHNAPALTERFVEALNYYAALFDCLEVVAARGSVERARVERWMLGEEI 246
                                   522233444799********************************************************************* PP

                          GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   +n+vac gaerrerhe+le+W +r+e aGF+ vpls++a  qa++  +  + dg++v ee+gs++l+W+dr+++svSaWr
  Zjn_sc00034.1.g01400.1.am.mk 247 KNIVACDGAERRERHERLERWARRMEGAGFGRVPLSYYALLQARRAAQGLGCDGFKVREEKGSFFLCWQDRAIFSVSAWR 326
                                   *******************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.9951306IPR005202Transcription factor GRAS
PfamPF035145.3E-1009326IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MLMPRAAPTA AEVAAARRHI VDLCPFLRLA GAAANQSVLE VMEAEKVVHV VDLGGADATQ  60
WLELLHLFAA RPEGPPHLRL TGVSEHREIL TQTAMVLSKE AERLDVPFQF NPVVTRLDTL  120
DVESLRVKTG EALAITSSLQ LHCLLASDDD SAAVVGKDKD SRRSPESGLS PSTSRVDAFL  180
GALWGLSPKI VVVTEQEASH NAPALTERFV EALNYYAALF DCLEVVAARG SVERARVERW  240
MLGEEIKNIV ACDGAERRER HERLERWARR MEGAGFGRVP LSYYALLQAR RAAQGLGCDG  300
FKVREEKGSF FLCWQDRAIF SVSAWRGRRI D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-44432663375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456925.10.0hypothetical protein SORBIDRAFT_03g045660
SwissprotQ9LPR81e-127SCL3_ARATH; Scarecrow-like protein 3
TrEMBLC5XHT90.0C5XHT9_SORBI; Putative uncharacterized protein Sb03g045660
STRINGSb03g045660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-102scarecrow-like 3